Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLE GLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSK CRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCE HGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCR KHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVR KNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
    • Molecular weight

      62 kDa including tags
    • Amino acids

      1 to 235

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131871 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ALPS 1A
    • ALPS1A
    • APO 1
    • Apo 1 antigen
    • APO 1 cell surface antigen
    • Apo-1 antigen
    • APO1
    • Apo1 antigen
    • APO1 cell surface antigen
    • Apoptosis antigen 1
    • Apoptosis mediating surface antigen FAS
    • Apoptosis-mediating surface antigen FAS
    • APT 1
    • APT1
    • CD 95
    • CD 95 antigen
    • CD95
    • CD95 antigen
    • Delta Fas
    • Delta Fas/APO 1/CD95
    • Delta Fas/APO1/CD95
    • Fas
    • Fas (TNF receptor superfamily, member 6)
    • FAS 1
    • FAS 827dupA
    • Fas AMA
    • FAS Antigen
    • Fas cell surface death receptor
    • FAS1
    • FASLG receptor
    • FASTM
    • sFAS
    • Surface antigen APO1
    • TNF receptor superfamily, member 6
    • TNFRSF 6
    • TNFRSF6
    • TNR6_HUMAN
    • Tumor necrosis factor receptor superfamily member 6
    see all
  • Function

    Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro).
  • Tissue specificity

    Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6.
  • Involvement in disease

    Defects in FAS are the cause of autoimmune lymphoproliferative syndrome type 1A (ALPS1A) [MIM:601859]; also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly.
  • Sequence similarities

    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Domain

    Contains a death domain involved in the binding of FADD, and maybe to other cytosolic adapter proteins.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131871 stained with Coomassie Blue.

References

ab131871 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131871.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up