Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKT ARRDLFGLSVLIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGT GECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPEFVGLWLGLAK AGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGKSL IKFCSGDLGPEGILPDTHLLDPLLKEASTAPLAQIPSKGMDDRLFYIYTS GTTGLPKAAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIG VGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVR EAERRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMD GKVGSCGFNSRILPHVYPIRLVKVNEDTMELLRDAQGLCIPCQAGEPGLL VGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLSGDVLVMDELG YMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGK AGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQ KTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL
    • Molecular weight

      98 kDa including tags
    • Amino acids

      1 to 646

Specifications

Our Abpromise guarantee covers the use of ab132799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACSVL5
    • FATP
    • FATP 1
    • FATP1
    • Fatty acid transport protein 1
    • FLJ00336
    • Long chain fatty acid transport protein 1
    • MGC71751
    • SLC27A1
    • Solute carrier family 27 (fatty acid transporter) member 1
    • Solute carrier family 27 member 1
    see all
  • Relevance

    SLC27A1 (Solute carrier family 27 member 1) is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. SLC27A1 may act directly as a bona fide transporter, or alternatively, in a cytoplasmic or membrane-associated multimeric protein complex to trap and draw fatty acids towards accumulation. It also plays a pivotal role in regulating available LFCA substrates from exogenous sources in tissues undergoing high levels of beta-oxidation or triglyceride synthesis and may be involved in regulation of cholesterol metabolism.
  • Cellular localization

    Cell membrane; Single-pass membrane protein. Intracytoplasmic membrane; Single-pass membrane protein. Cytoplasm. Note=Plasma membrane and intracellular membranes, at least in adipocytes. Predominantly cytoplasmic in myocytes.

Images

  • 12.5% SDS-PAGE analysis of ab132799 stained with Coomassie Blue.

References

ab132799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up