Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YFFQDIGYFLKVAAVGRRVRSYGQRRPARTILRAFLEKARQTPHKPFLLF RDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLG
    • Amino acids
      25 to 123
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161236 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACSVL1
    • FACVL1
    • FATP 2
    • FATP-2
    • FATP2
    • Fatty acid coenzyme A ligase, very long chain 1
    • Fatty acid transport protein 2
    • Fatty-acid-coenzyme A ligase
    • hFACVL1
    • HsT17226
    • Long chain fatty acid CoA ligase
    • Long-chain-fatty-acid--CoA ligase
    • S27A2_HUMAN
    • Slc27a2
    • Solute carrier family 27 (fatty acid transporter), member 2
    • Solute carrier family 27 member 2
    • THCA CoA ligase
    • THCA-CoA ligase
    • Very long chain acyl CoA synthetase
    • Very long chain fatty acid CoA ligase
    • Very long chain fatty acid coenzyme A ligase 1
    • very long-chain 1
    • Very long-chain acyl-CoA synthetase
    • Very long-chain-fatty-acid-CoA ligase
    • VLACS
    • VLCS
    see all
  • Function
    Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precurors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism. May be involved in translocation of long-chain fatty acids (LFCA) across membranes.
  • Tissue specificity
    Expressed in liver, kidney, placenta and pancreas.
  • Sequence similarities
    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization
    Endoplasmic reticulum membrane. Peroxisome membrane. Peripheral membrane associated with the lumenal side of peroxisomes.
  • Information by UniProt

Images

  • ab161236 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161236 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161236.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up