Overview

  • Product name
    Recombinant Human FBG4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PPRSLVTRCRPVCRAWRDIVDGPTVWLLQLARDRSAEGRALYAVAQRCLP SNEDKEEFPLCALARYCLRAPFGRNLIFNSCGEQGFRGWEVEHGGNGWAI
    • Amino acids
      34 to 133
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165069 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • F box only protein 17
    • F box only protein 26
    • F-box only protein 17
    • F-box only protein 26
    • F-box protein 17
    • F-box protein FBG4
    • FBX17
    • FBX17_HUMAN
    • FBX26
    • Fbxo17
    • FBXO26
    • FLJ11798
    • FLJ25205
    • FLJ58300
    • MGC9379
    see all
  • Function
    Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Able to recognize and bind denatured glycoproteins, which are modified with complex-type oligosaccharides. Also recognizes sulfated glycans. Does not bind high-mannose glycoproteins.
  • Tissue specificity
    Expressed in heart, skeletal muscle, liver and kidney. Expressed at lower levels in spleen and brain.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 1 FBA (F-box associated) domain.
  • Information by UniProt

Images

  • ab165069 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165069 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165069.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up