Overview

  • Product name

    Recombinant Human FbxL12 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLT LYTMRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQK CPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAWLHKQQDPTVL PLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQE LSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEG MPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAE KILCKGLPHCMVIVRACPKESMDWWM
    • Molecular weight

      62 kDa including tags
    • Amino acids

      1 to 326

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131975 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • F box and leucine rich repeat protein 12
    • F box protein FBL12
    • F box/LRR repeat protein 12
    • F-box and leucine-rich repeat protein 12
    • F-box protein FBL12
    • F-box/LRR-repeat protein 12
    • Fbl12
    • FBXL 12
    • FBXL12
    • FLJ20188
    • FXL12_HUMAN
    see all
  • Function

    Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 8 LRR (leucine-rich) repeats.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131975 at approximately 61.6 kDa.

References

ab131975 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131975.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up