Overview

  • Product name
    Recombinant Human FBXL20 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQ VSRAWNVLALDGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRG CLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDL ASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKAL FLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQ SLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHE LEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGA CAHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRL RTHLPNIKVHAYFAPVTPPPSVGGSRQRFCRCCIIL
    • Amino acids
      1 to 436
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • F box and leucine rich repeat protein 20
    • F box/LRR repeat protein 2 like
    • F box/LRR repeat protein 20
    • Fbl2
    • Fbl20
    • MGC15482
    • SCR
    • SCRAPPER
    see all
  • Relevance
    FBXL20 is a member of the F-box protein family, which are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. FBXL20 is selectively expressed in the brain, broadly expressed within the mouse CNS and is abundant at presynaptic membrane. FBXL20 has orthologs in C. elegans, D. melanogaster, and mammals which suggests that it might function as an important membrane-localized E3 ligase in various species. FBXL20 is a major presynaptic E3 ubiquitin ligase that acts through RIM1a via degradation and the ubiquitin-proteasome-system (UPS) pathway to critically regulate synaptic transmission. This identifies protein degradation as a mechanism for holding synaptic communication in check.
  • Cellular localization
    Cytoplasmic

Images

  • ab164715 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up