Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      LIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNL SGCLTITGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGF RACCRSGE
    • Amino acids

      584 to 691
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • F box and leucine rich repeat protein 5
    • F box protein FBL5
    • F box/LRR repeat protein 5
    • F-box and leucine-rich repeat protein 5
    • F-box protein FBL4/FBL5
    • F-box/LRR-repeat protein 5
    • FBL4
    • FBL5
    • FBXL5
    • FBXL5_HUMAN
    • FLR1
    • p45SKP2 like protein
    • p45SKP2-like protein
    see all
  • Function

    Component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in iron homeostasis by promoting the ubiquitination and subsequent degradation of IREB2/IRP2. Upon high iron and oxygen level, it specifically recognizes and binds IREB2/IRP2, promoting its ubiquitination and degradation by the proteasome. Promotes ubiquitination and subsequent degradation of DCTN1/p150-glued.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 7 LRR (leucine-rich) repeats.
  • Domain

    The hemerythrin-like region acts as an oxygen and iron sensor by binding oxygen through a diiron metal-center. In absence of oxygen and iron, the protein is ubiquitinated and degraded.
  • Post-translational
    modifications

    Ubiquitinated upon iron and oxygen depletion, leading to its degradation by the proteasome. Ubiquitination is regulated by the hemerythrin-like region that acts as an oxygen and iron sensor.
  • Cellular localization

    Cytoplasm > perinuclear region.
  • Information by UniProt

Images

  • ab161938 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up