Description

  • Product name

    Recombinant Human FBXO11 protein
  • Purity

    >= 28 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VAEESGPGAQNSPYQLRRKTLLPKRTACPTKNSMEGASTSTTENFGHRAK RARVSGKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKR FSELANDPILWKRLYMEVFEYTRPMMHPEPGKFYQINPEEYEHPNPWKES FQQLYKGAHVKPGFAEHFYSNPARYKGRENMLYYDTIEDALGGVQEAHFD GLIFVHSGIYTDEWIYIESPITMIGAAPGKVADKVIIENTRDSTFVFMEG SEDAYVGYMTIRFNPDDKSAQHHNAHHCLEITVNCSPIIDHCIIRSTCTV GSAVCVSGQGACPTIKHCNISDCENVGLYITDHAQGIYEDNEISNNALAG IWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVK AYANPTVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSD PTIRGNSIFNGNQGGVYIFGDGRGLIEGNDIYGNALAGIQIRTNSCPIVR HNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVLRRNRI HSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQ NGGILVYNSGLGCIEDNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGI CIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRKNRIFDGFAAGIEITN HATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDAIEKAVSRGQC LYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDR FFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN
    • Predicted molecular weight

      96 kDa including tags
    • Amino acids

      2 to 843
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      (NM_025133).

Specifications

Our Abpromise guarantee covers the use of ab196422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT

General Info

  • Alternative names

    • F box only protein 11
    • F box protein 11
    • F-box only protein 11
    • FBX11
    • FBX11_HUMAN
    • Fbxo11
    • PRMT9
    • Protein arginine N methyltransferase 9
    • Ubiquitin protein ligase E3 component n recognin 6
    • UBR6
    • UG063H01
    • VIT 1
    • VIT-1
    • VIT1
    • Vitiligo associated protein 1
    • Vitiligo associated protein VIT 1
    • Vitiligo-associated protein 1
    see all
  • Function

    Substrate recognition component of the a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Binds to and neddylates phosphorylated p53/TP53, inhibiting its transcriptional activity. SCF(FBXO11) does not seem to direct ubiquitination of TP53.
  • Tissue specificity

    Isoform 5 is expressed in keratinocytes, fibroblasts and melanocytes.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 F-box domain.
    Contains 19 PbH1 repeats.
    Contains 1 UBR-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of 1 µg ab196422 with Coomassie staining.

References

ab196422 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up