Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVPG PSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQ
    • Amino acids
      191 to 290
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161575 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CENP 30
    • Centromere protein 30
    • F box only protein 28
    • F box protein 28
    • F-box only protein 28
    • Fbx28
    • FBX28_HUMAN
    • FBXO28
    • FLJ10766
    • KIAA0483
    • OTTHUMP00000035597
    see all
  • Function
    Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.
  • Sequence similarities
    Contains 1 F-box domain.
  • Information by UniProt

Images

  • ab161575 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161575 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161575.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up