Description

  • Product name

    Recombinant Human FBXO3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHD PLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAW DDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHN GQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCI HTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFT SYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVG EFPIISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFH MACPTFRVSIARLEMGPDEYEEMEEEEEEEEEEDEDDDSADMDESDEDDE EERRRRVFDVPIRRRRCSRLF
    • Amino acids

      1 to 471
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • F Box G - Domain 3
    • F box only protein 3
    • F box protein 3
    • F box protein FBX3
    • F-box only protein 3
    • FBA
    • FBX3
    • FBX3_HUMAN
    • FBXO3
    see all
  • Function

    Substrate recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Mediates the ubiquitination of HIPK2 and probably that of EP300, leading to rapid degradation by the proteasome. In the presence of PML, HIPK2 ubiquitination still occurs, but degradation is prevented. PML, HIPK2 and FBXO3 may act synergically to activate p53/TP53-dependent transactivation.
  • Sequence similarities

    Contains 1 apaG domain.
    Contains 1 F-box domain.
  • Cellular localization

    Nucleus. Colocalizes with PML at the peripheries of nuclear bodies.
  • Information by UniProt

Images

  • ab161962 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up