Overview

  • Product name

    Recombinant Human FBXO31 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVK KDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILM KFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFH GRRARGTKITGDPNIPAGQQTVEIDLRHRIQLPDLENQRNFNELSRIVLE VRERVRQEQQEGGHEAGEGRGRQGPRESQPSPAQPRAEAPSKGPDGTPGE DGGEPGDAVAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGL IAGHGFTSPERTPGVFILFDEDRFGFVWLELKSFSLYSRVQATFRNADAP SPQAFDEMLKNIQSLTS
    • Molecular weight

      68 kDa including tags
    • Amino acids

      173 to 539

Specifications

Our Abpromise guarantee covers the use of ab132762 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp434B027
    • DKFZp434J1815
    • F box only protein 31
    • F box protein 31
    • F-box only protein 31
    • FBX14
    • FBX31
    • FBX31_HUMAN
    • FBXO14
    • Fbxo31
    • FLJ22477
    • MGC15419
    • MGC9527
    • pp2386
    • Putative breast cancer tumor suppressor
    • SCF ubiquitin ligase specificity factor
    see all
  • Function

    Component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in G1 arrest following DNA damage. Specifically recognizes phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, resulting in G1 arrest. May act as a tumor suppressor.
  • Tissue specificity

    Highly expressed in brain. Expressed at moderate levels in most tissues, except bone marrow.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the FBXO31 family.
    Contains 1 F-box domain.
  • Developmental stage

    Expression is cell-cycle regulated, and peaks at late G2 to early G1 phase (at protein level).
  • Post-translational
    modifications

    Phosphorylation at Ser-278 by ATM following gamma-irradiation results in its stabilization.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132762 stained with Coomassie Blue.

References

ab132762 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132762.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up