Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PDCGSKYQLCVQLLSSAHAPLGTFQPDPATIQQKSDAKWREVSHTFSNYP PGVRYIWFQHGGVDTHYWAGWYGPRVTNSSITIGPPLP
    • Amino acids
      168 to 255
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5730411K09
    • AV001623
    • DKFZp781J0852
    • F box gene 3
    • F box only protein 44
    • F box only protein 6a
    • F box protein 44
    • F box protein FBX30
    • F box/G domain protein 3
    • F-box only protein 44
    • F-box protein FBX30
    • F-box/G-domain protein 3
    • FBG3
    • FBX30
    • FBX44
    • FBX44_HUMAN
    • FBX6A
    • Fbxo44
    • Fbxo6a
    • MGC14140
    • RGD1562463
    see all
  • Function
    Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
  • Tissue specificity
    Abundantly expressed in brain and kidney. Expressed at lower levels in heart, spleen and liver.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 1 FBA (F-box associated) domain.
  • Information by UniProt

Images

  • ab164941 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up