Recombinant Human FBXO45 protein (ab165874)

Overview

  • Product name
    Recombinant Human FBXO45 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLA EEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIA QSTDGARTKI
    • Amino acids
      39 to 148
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • F box protein 45
    • F-box only protein 45
    • F-box/SPRY domain-containing protein 1
    • FBSP1_HUMAN
    • FBX45
    • fbxo45
    • hFbxo45
    see all
  • Function
    Component of E3 ubiquitin ligase complexes. Required for normal neuromuscular synaptogenesis, axon pathfinding and neuronal migration (By similarity). Plays a role in the regulation of neurotransmission at mature neurons (By similarity). May controls synaptic activity by controlling UNC13A via ubiquitin dependent pathway (By similarity). Specifically recognizes TP73, promoting its ubiquitination and degradation.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the FBXO45/Fsn family.
    Contains 1 B30.2/SPRY domain.
    Contains 1 F-box domain.
  • Cellular localization
    Cell junction > synapse > postsynaptic cell membrane. Cell junction > synapse > presynaptic cell membrane.
  • Information by UniProt

Images

  • ab165874 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up