Description

  • Product name

    Recombinant Human FBXO7 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITL NYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQN NEQPSLATSSNQTSIQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAES IQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALI VLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATL TCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKD LQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVR SVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRH IQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQ RPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGG PNDRFPFRPSRGRPTDGRLSFM
    • Amino acids

      1 to 522
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • F box only protein 7
    • F box protein 7
    • F-box only protein 7
    • FBX
    • FBX07
    • FBX7
    • FBX7_HUMAN
    • Fbxo7
    • PARK15
    • PKPS
    see all
  • Function

    Substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes BIRC2 and DLGAP5.
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Defects in FBXO7 are the cause of Parkinson disease type 15 (PARK15) [MIM:260300]; also known as parkinsonian-pyramidal syndrome. A neurodegenerative disorder characterized by parkinsonian and pyramidal signs. Clinical manifestations include tremor, bradykinesia, rigidity, postural instability, spasticity, mainly in the lower limbs, and hyperreflexia.
  • Sequence similarities

    Contains 1 F-box domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab161784 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161784 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161784.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up