Overview

  • Product name
    Recombinant Human Fbxw7 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKL WDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLL VLDFDVDMK
    • Amino acids
      599 to 707
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163053 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGO
    • Archipelago
    • Archipelago homolog
    • Archipelago, Drosophila, homolog of
    • CDC4
    • CDC4, S.cerevisiae, homolog of
    • DKFZp686F23254
    • F box and WD 40 domain protein 7
    • F box and WD 40 domain protein 7 (archipelago homolog, Drosophila)
    • F box and WD repeat domain containing 7
    • F box protein FBW7
    • F box protein FBX30
    • F box protein SEL 10
    • F box protein SEL10
    • F-box and WD repeat domain containing 7, E3 ubiquitin protein ligase
    • F-box and WD-40 domain-containing protein 7
    • F-box protein FBX30
    • F-box/WD repeat-containing protein 7
    • FBW6
    • FBW7
    • FBX30
    • FBXO30
    • FBXW6
    • FBXW7
    • FBXW7_HUMAN
    • FLJ16457
    • hAgo
    • hCdc4
    • Homolog of C elegans sel 10
    • Homolog of C.elegans sel10
    • SEL 10
    • SEL-10
    • SEL10
    see all
  • Function
    Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1.
  • Tissue specificity
    Isoform 1 is widely expressed. Isoform 4 is expressed in brain.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 7 WD repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm; Nucleus; Nucleus > nucleolus and Nucleus > nucleoplasm.
  • Information by UniProt

Images

  • ab163053 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163053 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163053.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up