Bioactive grade

Recombinant human Fc epsilon RI/FCER1A protein (ab182693)

Description

  • Product name

    Recombinant human Fc epsilon RI/FCER1A protein
    See all Fc epsilon RI/FCER1A proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human FCER1A at 2 μg/ml (100 μl/well).

    The concentration of Human IgE that produces 50% of the optimal binding response is found to be approximately 0.1 - 0.4 µg/ml.

  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETN SSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEG QPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYY CTGKVWQLDYESEPLNITVIKAPREKYWLQ
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      26 to 205
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain. NP_001992.

Specifications

Our Abpromise guarantee covers the use of ab182693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Fc epsilon RI

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Reconstitute for long term storage.

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Fc epsilon RI alpha
    • Fc epsilon RI alpha chain
    • Fc epsilon RI alpha-chain
    • Fc fragment of IgE high affinity I receptor for alpha polypeptide
    • Fc fragment of IgE, high affinity I, receptor for, alpha subunit
    • Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
    • Fc IgE receptor alpha polypeptide
    • Fc IgE receptor, alpha chain
    • Fc IgE receptor, alpha polypeptide
    • Fc of IgE high affinity I receptor for alpha polypeptide
    • Fc-epsilon RI-alpha
    • FCE 1A
    • FCE1A
    • FCER 1A
    • Fcer1a
    • FCERA_HUMAN
    • FcERI
    • FceRI alpha
    • high affinity IgE receptor
    • High affinity immunoglobulin epsilon receptor alpha subunit
    • high affinity immunoglobulin epsilon receptor alpha-subunit
    • High affinity immunoglobulin epsilon receptor subunit alpha
    • IgE Fc receptor alpha subunit
    • IgE Fc receptor subunit alpha
    • Immunoglobulin E receptor high affinity of mast cells alpha polypeptide
    • immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
    see all
  • Function

    Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
  • Sequence similarities

    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • Immobilized Immunoglobulin E, Human Plasma at 5 µg/mL (100 µL/well) can bind Human Fc epsilon RI alpha, His Tag with a linear range of 0.4-3 ng/mL.
  • SDS-PAGE analysis of reduced ab182693 stained overnight with Coomassie Blue.

References

ab182693 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182693.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up