Description

  • Product name

    Recombinant Human FCAMR protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYAPSSVNRH QRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRLSQ LSPDDIGC
    • Amino acids

      63 to 170
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD351
    • Fc alpha/mu receptor
    • Fc receptor, IgA, IgM, high affinity
    • Fcamr
    • FCAMR_HUMAN
    • FKSG87
    • High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
    • Immunity related factor
    • Receptor for Fc fragment of IgA and IgM
    see all
  • Function

    Functions as a receptor for the Fc fragment of IgA and IgM. Binds IgA and IgM with high affinity and mediates their endocytosis. May function in the immune response to microbes mediated by IgA and IgM.
  • Tissue specificity

    Expressed by mesangial cells.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab164473 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164473 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up