Description

  • Product name

    Recombinant Human FCN1/M-Ficolin protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTIL RGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRG EKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDT DGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQG SSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTG HNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESY ANGINWSAAKGYKYSYKVSEMKVRPA
    • Amino acids

      1 to 326
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as FCN1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Collagen/fibrinogen domain containing protein 1
    • Collagen/fibrinogen domain-containing protein 1
    • Fcn1
    • FCN1_HUMAN
    • FCNM
    • ficolin (collagen/fibrinogen domain containing) 1
    • Ficolin 1
    • Ficolin A
    • Ficolin alpha
    • Ficolin-1
    • Ficolin-A
    • Ficolin-alpha
    • M ficolin
    • M-ficolin
    see all
  • Function

    Involved in serum exerting lectin activity. Binds GlcNAc.
  • Tissue specificity

    Peripheral blood leukocytes. Also detected in spleen, lung, and thymus, may be due to the presence of tissue macrophages or trapped blood in these tissues. Not detected on lymphocytes and granulocytes.
  • Sequence similarities

    Belongs to the ficolin lectin family.
    Contains 1 collagen-like domain.
    Contains 1 fibrinogen C-terminal domain.
  • Cellular localization

    Secreted. Found on the monocyte surface.
  • Information by UniProt

Images

  • ab158424 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up