Overview

  • Product name

    Recombinant Human FcRgamma protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV RKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
    • Molecular weight

      36 kDa including tags
    • Amino acids

      1 to 86

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as FCER1G.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
    • Fc receptor gamma chain
    • Fc-epsilon RI-gamma
    • FCER1G
    • FCERG_HUMAN
    • FceRI gamma
    • FCRG
    • FcRgamma
    • High affinity immunoglobulin epsilon receptor subunit gamma
    • IgE Fc receptor subunit gamma
    • Immunoglobulin E receptor, high affinity, gamma chain
    see all
  • Function

    Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface.
  • Sequence similarities

    Belongs to the CD3Z/FCER1G family.
    Contains 1 ITAM domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152381 stained with Coomassie Blue.

References

ab152381 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up