Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWS SSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLE TQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTA EYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPR AQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSL TEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNVDHHHHHH
    • Molecular weight

      32 kDa including tags
    • Amino acids

      17 to 303
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.03% EDTA, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • CD307a
    • Fc receptor homolog 1
    • Fc receptor like protein 1
    • Fc receptor-like protein 1
    • FcR like protein 1
    • FcR-like protein 1
    • FCRH 1
    • FcRH1
    • FCRL 1
    • FcRL1
    • FCRL1_HUMAN
    • hIFGP 1
    • hIFGP1
    • IFGP 1
    • IFGP family protein 1
    • IFGP1
    • Immune receptor translocation associated protein 5
    • Immune receptor translocation-associated protein 5
    • immunoglobulin superfamily Fc receptor, gp42
    • IRTA 5
    • IRTA5
    • RP11 367J7.7
    see all
  • Information by UniProt

References

ab152074 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152074.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up