Overview

  • Product name
    Recombinant Human FCRL2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLWSLLVIFDAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIQKMA YHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKI KVQELFQRPV
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD307b
    • Fc receptor homolog 2
    • Fc receptor like protein 2
    • Fc receptor-like protein 2
    • FcR-like protein 2
    • FcRH2
    • FCRL 2
    • FcRL2
    • FCRL2_HUMAN
    • IFGP family protein 4
    • IFGP4
    • Immunoglobulin receptor translocation associated 4 protein
    • Immunoglobulin receptor translocation-associated protein 4
    • IRTA4
    • SH2 domain containing phosphatase anchor protein 1
    • SH2 domain-containing phosphatase anchor protein 1
    • SPAP1
    see all
  • Function
    May have an regulatory role in normal and neoplastic B cell development.
  • Tissue specificity
    Expressed in the secondary lymphoid organs, spleen and lymph node. Expression is limited to the mature B-cell lines. Highly expressed in CD19 and within the mantle zones of the tonsil tissue. Isoform 2 is expressed in the spleen, peripheral blood and bone marrow. Isoform 2 and isoform 4 are expressed in B-cell lines. Preferentially expressed in memory B-cells (at protein level).
  • Sequence similarities
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain
    Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). The phosphorylated ITIM motif bind the SH2 domain of PTPN6.
  • Post-translational
    modifications
    Isoform 2 is N- and O-glycosylated, and phosphorylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab164022 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up