Overview

  • Product name

    Recombinant Human FCRL6 protein (His tag)
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLS MGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPS PEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPG AKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPA VGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQ DAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW
    • Molecular weight

      36 kDa including tags
    • Amino acids

      20 to 307
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab225642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Fc receptor homolog 6
    • Fc receptor-like 6
    • Fc receptor-like protein 6
    • Fc receptor-like protein 7
    • FcR-like protein 6
    • FcRH6
    • FcRL6
    • FCRL6_HUMAN
    • FLJ16056
    • IFGP6
    • IgSF type I transmembrane receptor
    • leukocyte receptor
    see all
  • Tissue specificity

    Expressed by cytolytic cells including NK cells, effector and effector-memory CD8+ T-cells. Expression among T-cells is greatly expanded in HIV-1 infected individuals, and includes not only effector and effector-memory CD8+ T-cells but also populations of CD4+ T-cells.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). The phosphorylated ITIM motif is involved in PTPN11 binding.
  • Post-translational
    modifications

    Phosphorylated on Tyr residue, inducing association with PTPN11.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225642 with 5% enrichment gel and 15% separation gel.

References

ab225642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up