Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DSLASCKAGAASPILGCRTRAECQSGCDMKRLAWSLFLSSFPRPSWTRSP CPTFQKAPLPPPRGHTASSPPPLVCGSARSPRGKQE
    • Amino acids
      89 to 174
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fc receptor homolog expressed in B cells protein 2
    • Fc receptor like B
    • Fc receptor like mucin like 2
    • Fc receptor like protein 2
    • Fc receptor related Y
    • FCRL2
    • FCRLM2
    • FCRLY
    • Fcry
    • FLJ31052
    • FREB 2
    • FREB2
    • mFCRL2
    • RGD1563018
    • RP11-474I16.6
    see all
  • Relevance
    FCRLB belongs to the Fc receptor family. Fc receptors are involved in phagocytosis, antibody-dependent cell cytotoxicity, immediate hypersensitivity, and transcytosis of immunoglobulins via their ability to bind immunoglobulin (Ig) constant regions.
  • Cellular localization
    Cytoplasm. Endoplasmic reticulum. Note: Seems not to be secreted.

Images

  • ab165293 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up