Overview

  • Product name
    Recombinant Human FCRLM1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLKKISVGVAGDLNTVTMKLGCVLMAWALYLSLGVLWVAQMLLAASFETL QCEGPVCTEESSCHTEDDLTDAREAGFQVKAYTFSEPFHLIVSYDWLILQ GPAKPVFEGDLLVLRCQAWQDWPLTQVTFYRDGSALGPPGPNREFSITVV QKADSGHYHCSGIFQSPGPGIPETASVVAITVQELFPAPILRAVPSAEPQ AGSPMTLSCQTKLPLQRSAARLLFSFYKDGRIVQSRGLSSEFQIPTASED HSGSYWCEAATEDNQVWKQSPQLEIRVQGASSSAAPPTLNPAPQKSAAPG TAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRV LLGHLLMELRELSGHRKPGTTKATAE
    • Amino acids
      1 to 376
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fc receptor homolog expressed in B cells
    • Fc receptor homolog expressed in B cells (FREB)
    • Fc receptor like A
    • Fc receptor like and mucin like 1
    • Fc receptor like and mucin like protein 1
    • Fc receptor like protein
    • Fc receptor related protein X
    • FCRL
    • FCRL1
    • FCRLa
    • FCRLb
    • FCRLc1
    • FCRLc2
    • FCRLd
    • FCRLe
    • FCRLM1
    • FCRLX
    • FcRX
    • FREB
    • MGC4595
    • RP11 474I16.5
    see all
  • Relevance
    FCRLM1 belongs to a family of receptors for the Fc fragment of IgG, or FCGRs which are cell surface glycoproteins of the Ig superfamily (IgSF). These receptors mediate phagocytosis of IgG-coated pathogens and promote activation of effector cells, leading to inflammatory responses and antibody-mediated cellular cytotoxicity. FCRLM1 may be involved in B-cell differentiation and lymphomagenesis.
  • Cellular localization
    Secreted. Cytoplasm.

Images

  • ab164666 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164666 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up