Overview

  • Product name

    Recombinant Human FDCSP protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSFPVSQDQEREKRSISDSDELASGFFVF PYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK
    • Molecular weight

      10 kDa including tags
    • Amino acids

      18 to 85
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab139238 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.02% DTT, 0.32% Tris HCl, 50% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • C4orf7
    • FDC secreted protein
    • FDC-SP
    • FDCSP
    • FDSCP_HUMAN
    • Follicular dendritic cell secreted peptide
    • Follicular dendritic cell secreted protein
    see all
  • Function

    Can bind to the surface of B-lymphoma cells, but not T-lymphoma cells, consistent with a function as a secreted mediator acting upon B-cells.
  • Tissue specificity

    Abundantly expressed in tonsil, lymph node, and trachea; strong expression in prostate; lower expression in thyroid, stomach, and colon.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139238.

References

ab139238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up