Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYL VCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL
    • Amino acids
      401 to 490
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • F1A alpha
    • F1A-alpha
    • F1AA
    • Fem-1-like death receptor-binding protein alpha
    • Fem-1-like in apoptotic pathway protein alpha
    • Fem1 homolog b
    • FEM1 like death receptor binding protein
    • FEM1-beta
    • FEM1b
    • FEM1B_HUMAN
    • Protein fem-1 homolog B
    see all
  • Function
    Component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. Involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. Also involved in glucose homeostasis in pancreatic islet. Functions as an adapter/mediator in replication stress-induced signaling that leads to the activation of CHEK1.
  • Tissue specificity
    Widely expressed. Highly expressed in testis. Weakly expressed in other tissues.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the fem-1 family.
    Contains 8 ANK repeats.
    Contains 1 TPR repeat.
  • Cellular localization
    Cytoplasm. Nucleus. In the nucleus, the protein level increased slightly after camptothecin (CPT) treatment. Associated with chromatin.
  • Information by UniProt

Images

  • ab160830 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up