Description

  • Product name

    Recombinant Human FEM1A protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDLRTAVYNAARDGKLQLLQKLLSGRSREELDELTGEVAGGGTPLLIAAR YGHLDVVEYLVDRCGASVEAGGSVHFDGETIEGAPPLWAASAAGHLDVVR SLLRRGASVNRTTRTNSTPLRAACFDGHLEVVRYLVGEHQADLEVANRHG HTCLMISCYKGHREIARYLLEQGAQVNRRSAKGNTALHDCAESGSLEILQ LLLGCKARMERDGYGMTPLLAASVTGHTNIVEYLIQEQPGQEQVAGGEAQ PGLPQEDPSTSQGCAQPQGAPCCSSSPEEPLNGESYESCCPTSREAAVEA LELLGATYVDKKRDLLGALKHWRRAMELRHQGGEYLPKPEPPQLVLAYDY SREVNTTEELEALITDPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVY ADSGNFERCIRLWKYALDMQQSNLEPLSPMTASSFLSFAELFSYVLQDRA AKGSLGTQIGFADLMGVLTKGVREVERALQLPREPGDSAQFTKALAIILH LLYLLEKVECTPSQEHLKHQTVYRLLKCAPRGKNGFTPLHMAVDKDTTNV GRYPVGRFPSLHVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPAIMNAL IEAGAHMDATNAFKKTAYELLDEKLLARGTMQPFNYVTLQCLAARALDKN KIPYKGFIPEDLEAFIELH
    • Amino acids

      1 to 669
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AW611390
    • DKFZp762M136
    • EPRAP
    • Fem-1 homolog a (C. elegans)
    • Fem1 homolog a
    • FEM1-alpha
    • FEM1-alpha-A
    • FEM1a
    • FEM1a-A
    • FEM1A_HUMAN
    • Fem1aa
    • Feminization 1 homolog a
    • Feminization 1 homolog a (C. elegans)
    • MGC114562
    • MGC117925
    • Prostaglandin E receptor 4-associated protein
    • Protein fem-1 homolog A
    • Protein fem-1 homolog A-A
    see all
  • Function

    Probable component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit (By similarity). May participate in antiinflammatory signaling via its interaction with PTGER4.
  • Tissue specificity

    Present in macrophages derived from peripheral blood monocytes. Also present in atheromata (at protein level).
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the fem-1 family.
    Contains 9 ANK repeats.
    Contains 2 TPR repeats.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab163115 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up