Overview

  • Product name

    Recombinant Human FENS1/WDFY1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAEIHSRPQSSRPVLLSKIEGHQDAVTAALLIPKEDGVITASEDRTIRV WLKRDSGQYWPSIYHTMASPCSAMAYHHDSRRIFVGQDNGAVMEFHVSED FNKMNFIKTYPAHQNRVSAIIFSLATEWVISTGHDKCVSWMCTRSGNMLG RHFFTSWASCLQYDFDTQYAFVGDYSGQITLLKLEQNTCSVITTLKGHEG SVACLWWDPIQRLLFSGASDNSIIMWDIGGRKGRTLLLQGHHDKVQSLCY LQLTRQLVSCSSDGGIAVWNMDVSREEAPQWLESDSCQKCEQPFFWNIKQ MWDTKTLGLRQHHCRKCGQAVCGKCSSKRSSYPVMGFEFQVRVCDSCYDS IKDEDRTSLATFHEGKHNISHMSMDIARGLMVTCGTDRIVKIWDMTPVVG CSLATGFSPH
    • Amino acids

      1 to 410
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as FENS1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FENS 1
    • FENS-1
    • FENS1
    • KIAA1435
    • Phosphoinositide binding protein 1
    • Phosphoinositide binding protein SR1
    • Phosphoinositide-binding protein 1
    • WD repeat and FYVE domain containing 1
    • WD repeat and FYVE domain-containing protein 1
    • WD40 and FYVE domain containing protein 1
    • WD40- and FYVE domain-containing protein 1
    • WDF1
    • WDFY1
    • WDFY1_HUMAN
    • ZFYVE17
    • Zinc finger FYVE domain containing protein 17
    • Zinc finger FYVE domain-containing protein 17
    see all
  • Sequence similarities

    Contains 1 FYVE-type zinc finger.
    Contains 7 WD repeats.
  • Domain

    The FYVE-type zinc finger domain mediates interactions with phosphatidylinositol 3-phosphate in membranes of early endosomes and penetrates bilayers. The FYVE domain insertion into PtdIns(3)P-enriched membranes is substantially increased in acidic conditions.
  • Cellular localization

    Early endosome.
  • Information by UniProt

Images

  • ab163597 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up