Recombinant Human Ferredoxin Reductase protein (ab158427)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAG FYTAQHLLKHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTA HSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYGAEDHRALEIPGEELPG VCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPE HLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGA RPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASAS RAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMED LPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVK RGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPGYAAIQALLSSRGV RPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLGH
    • Amino acids
      1 to 491
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adrenodoxin reductase
    • ADRO_HUMAN
    • ADXR
    • AR
    • FDXR
    • Ferredoxin NADP(+) reductase
    • Ferredoxin reductase
    • Ferredoxin--NADP(+) reductase
    • mitochondrial
    • NADPH adrenodoxin oxidoreductase mitochondrial
    • NADPH:adrenodoxin oxidoreductase
    see all
  • Function
    Serves as the first electron transfer protein in all the mitochondrial P450 systems. Including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in the kidney, and sterol C-27 hydroxylation in the liver.
  • Pathway
    Steroid metabolism; cholesterol metabolism.
  • Sequence similarities
    Belongs to the ferredoxin--NADP reductase type 1 family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab158427 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up