Description

  • Product name

    Recombinant human FES protein
    See all FES proteins and peptides
  • Biological activity

    Specific activity of 235 pmol/min/µg.

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHM SLQDSGGQSRAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSK LSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKSQYRALARDSAQ AKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHH QLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAA AARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRE RVQLLGKRQVLQEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPV LLLQDDRHSTSSSEQEREGGR TPTLEILKSHISGIFRPKFSLPPPLQL IPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQEYVLSVLW DGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHR AVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLP PDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTF LRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVL KISDFGMSREEADGVYAASGGLRQVPVKWTAPEALNYGRYSSESDVWSFG ILLWETFSLGASPYPNLSNQQTREFVEKGGRLPCPELCPDAVFRLMEQCW AYEPGQRPSFSTIYQELQSIRKRHR
    • Predicted molecular weight

      95 kDa including tags
    • Amino acids

      2 to 822
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      Genbank #: NM_002005

Specifications

Our Abpromise guarantee covers the use of ab196084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.64% Tris HCl, 0.64% Sodium chloride, 0.0462% DTT, 0.017% Potassium chloride, 20% Glycerol

    Buffer also contains FLAG peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • c-fes/fps protein
    • cFES
    • Feline sarcoma (Snyder Theilen) viral (v fes)/Fujinami avian sarcoma (PRCII) viral (v fps) oncogene homolog
    • feline sarcoma (Snyder-Theilen) viral (v-fes)/Fujinami
    • Feline sarcoma oncogene
    • Feline sarcoma/Fujinami avian sarcoma oncogene homolog
    • fes
    • FES proto oncogene, tyrosine kinase
    • FES_HUMAN
    • FPS
    • Oncogene FES
    • Oncogene FES feline sarcoma virus
    • P93c fes
    • Proto oncogene tyrosine protein kinase Fes/Fps
    • Proto-oncogene c-Fes
    • Proto-oncogene c-Fps
    • proto-oncogene tyrosine-protein kinase Fes/Fps
    • Tyrosine-protein kinase Fes/Fps
    see all
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Fes/fps subfamily.
    Contains 1 FCH domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
  • Information by UniProt

Images

  • Analysis of ATP transfer with various amounts of ab196084. Assay was performed in a Kinase buffer (40 mM Tris pH 7.4, 10 mM MgCl2, 0.1 mg/mL BSA) containing 1 mM DTT using Poly-(Glu4:Tyr)substrate (0.2 mg/mL) and 20 µM ATP for 30 minutes at 30°C.

  • 10% SDS-PAGE analysis of ab196084 stained with Coomassie Blue.

References

ab196084 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196084.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up