Description

  • Product name

    Recombinant Human Fetuin B protein
    See all Fetuin B proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      CGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLN RVNDAQEYRRGGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYG QCKAIFYMNNPSRVLYLAAYNCTLRPVSKKKIYMTCPDCPSSIPTDSSNH QVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESP CTKSQASSCSLQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATG SENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGPRGSVQYLPDLDDKNS QEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPMEEKLVVLPFPKEKART AECPGPAQNASPLVLPP
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      16 to 382
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Full length mature form without signal peptide. AAH69670

Specifications

Our Abpromise guarantee covers the use of ab201420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 8.0
    Constituents: 0.61% Tris buffer, 0.87% Sodium chloride, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 1000 µL sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. No activity loss was observed after storage at: In lyophilized state for 1 year (4 degC); After reconstitution under sterile conditions for 3 months (-70 degC).

General Info

  • Alternative names

    • 16G2
    • 2310011O17Rik
    • AI255764
    • D17980
    • Fet
    • Fetub
    • FETUB_HUMAN
    • Fetuin beta
    • Fetuin-B
    • Fetuin-like protein
    • Fetuin-like protein IRL685
    • Gugu
    • IRL685
    • Pp63
    see all
  • Tissue specificity

    Liver and testis.
  • Sequence similarities

    Belongs to the fetuin family.
    Contains 2 cystatin fetuin-B-type domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • The purity of ab201420 was determined by DTT-reduced SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced protein migrates as 48-60 kDa in SDS-PAGE due to glycosylation.

References

ab201420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up