Overview

  • Product name

    Recombinant Human Fez1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFS SEIISFKSMEDLVNEFDEKLNVCFRNYNAKTENLAPVKNQLQIQEEEETL QDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKS ENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQA DSVLLQEMQALTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEEL VQQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQ SSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEK KASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT
    • Molecular weight

      72 kDa including tags
    • Amino acids

      1 to 392

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Glutathione, 0.32% Tris HCl

General Info

  • Alternative names

    • Fasciculation and elongation protein zeta 1
    • Fasciculation and elongation protein zeta-1
    • Fez
    • Fez 1
    • FEZ1
    • FEZ1_HUMAN
    • Fezl
    • Zygin 1
    • Zygin I
    • Zygin-1
    • Zygin1
    • ZyginI
    see all
  • Function

    May be involved in axonal outgrowth as component of the network of molecules that regulate cellular morphology and axon guidance machinery. Able to restore partial locomotion and axonal fasciculation to C.elegans unc-76 mutants in germline transformation experiments. May participate in the transport of mitochondria and other cargos along microtubules.
  • Tissue specificity

    Mainly expressed in brain.
  • Sequence similarities

    Belongs to the zygin family.
  • Post-translational
    modifications

    Phosphorylated by protein kinase C zeta; which enhances interaction with UBE4B and polyubiquitination.
    Polyubiquitinated in a UBE4B-dependent manner; which does not lead to proteasomal degradation and may be important for neurogenic activity. Polyubiquitin linkage seems to be mainly through Lys-26.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome. Cell membrane. Co-localizes with both, alpha- and gamma-tubulin. Translocated from the plasma membrane to the cytoplasm by activation of the PKC zeta.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132344 stained with Coomassie Blue.

References

ab132344 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up