Description

  • Product name

    Recombinant Human FGD2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKGASEEKLASVSNLVTVFENSRTPEAAPRGHRLEDVHHRPECRPPESPG PREKTNVGEAVGSEPRTVSRRYLNSLKNKLSSEAWRKSCQPVTLSGSGTQ EPEKKIVQELLETEQAYVARLHLLDQVFFQELLKTARSSKAFPEDVVRVI FSNISSIYQFHSQFFLPELQRRLDDWTANPRIGDVIQKLAPFLKMYSEYV KNFERAAELLATWTDKSPLFQEVLTRIQSSEASGSLTLQHHMLEPVQRIP RYELLLKEYIQKLPAQAPDQADAQKALDMIFSAAQHSNAAITEMERLQDL WEVYQRLGLEDDIVDPSNTLLREGPVLKISFRRNDPMERYLFLFNNMLLY CVPRVIQVGAQFQVRTRIDVAGMKVRELMDAEFPHSFLVSGKQRTLELQA RSQEEMISWMQAFQAAIDQIEKRNETFKAAAQGPEGDIQEQELQSEELGL RAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACGYVVCARCSDYRAELK YDDNRPNRVCLHCYAFLTGNVLPEAKEDKRRGILEKGSSATPDQSLMCSF LQLIGDKWGKSGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVT VGPQGDPRVFQLQQSGQLYTFKAETEELKGRWVKAMERAASGWSPSWPND GDLSD
    • Amino acids

      1 to 655
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FGD1 family member 2
    • Fgd2
    • FGD2_HUMAN
    • FLJ00276 protein
    • FYVE
    • FYVE RhoGEF and PH domain containing 2
    • RhoGEF and PH domain-containing protein 2
    • ZFYVE4
    • Zinc finger FYVE domain-containing protein 4
    see all
  • Function

    Activates CDC42, a member of the Ras-like family of Rho-and Rac proteins, by exchanging bound GDP for free GTP. Activates JNK1 via CDC42 but not RAC1. Binds to phosphatidylinositol 4,5-bisphosphate, phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate.
  • Sequence similarities

    Contains 1 DH (DBL-homology) domain.
    Contains 1 FYVE-type zinc finger.
    Contains 2 PH domains.
  • Domain

    The FYVE-type zinc-finger is necessary for early endosome localization. Recruitement to endosomal membranes via this domain requires the presence of phosphatidylinositol 3-phosphate or other phosphatidylinositides.
    The PH domain is necessary for localization to the ruffle membrane. Recruitement to ruffle membrane occurs through binding of phosphoinositides by the PH domain. This domain also contributes to the lipid-binding properties of the protein.
    The DH domain is necessary for its ability to activate JNK1 via CDC42.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasm. Nucleus. Early endosome. Early endosome membrane. Cell projection > ruffle membrane. Recruitement to the endosome and ruffle membrane requires the presence of phosphoinositides.
  • Information by UniProt

Images

  • ab165971 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up