Bioactive grade

Recombinant human FGF1 alpha protein (Active) (ab235721)

Description

  • Product name

    Recombinant human FGF1 alpha protein (Active)
    See all FGF1 alpha proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 0.5 ng/ml, corresponding to a specific activity of >2.0x106 IU/mg in the presence of 10 μg/ml of heparin.

  • Purity

    > 97 % SDS-PAGE.
    >97% as determined by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTR DRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLF LERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPL PVSSD
    • Predicted molecular weight

      18 kDa
    • Amino acids

      1 to 155

Associated products

Specifications

Our Abpromise guarantee covers the use of ab235721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 5% Trehalose, 0.01% DTT, 0.06% EDTA

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20 °C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • Acidic fibroblast growth factor
    • aFGF
    • Beta-endothelial cell growth factor
    • ECGF-beta
    • Endothelial cell growth factor
    • Fgf1
    • FGF1_HUMAN
    • HBGF-1
    • Heparin-binding growth factor 1
    see all
  • Function

    The heparin-binding fibroblast growth factors play important roles in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. They are potent mitogens in vitro.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted. Cytoplasm. Cytoplasm > cell cortex. Lacks a cleavable signal sequence. Within the cytoplasm, it is transported to the cell membrane and then secreted by a non-classical pathway that requires Cu(2+) ions and S100A13. Secreted in a complex with SYT1.
  • Information by UniProt

Images

  • SDS-PAGE analysis of recombinant human FGF1 alpha protein (Active) (ab235721).

References

ab235721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up