Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAES VGEVYIKSTE TGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVG LKKNGSCKRG PRTHYGQKAILFLPLPVSSD
    • Molecular weight
      16 kDa
    • Amino acids
      16 to 155
    • Additional sequence information
      This product is the mature full length protein from aa 16 to 155. The propeptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab155608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 200 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Acidic fibroblast growth factor
    • aFGF
    • Beta endothelial cell growth factor
    • Beta-endothelial cell growth factor
    • ECGF
    • ECGF beta
    • ECGF-beta
    • ECGFA
    • ECGFB
    • Endothelial Cell Growth Factor alpha
    • Endothelial Cell Growth Factor beta
    • FGF 1
    • FGF alpha
    • Fgf1
    • FGF1_HUMAN
    • FGFA
    • Fibroblast growth factor 1
    • Fibroblast Growth Factor 1 Acidic
    • GLIO703
    • HBGF 1
    • HBGF-1
    • HBGF1
    • Heparin binding growth factor 1
    • Heparin binding growth factor 1 precursor
    • Heparin-binding growth factor 1
    see all
  • Function
    The heparin-binding fibroblast growth factors play important roles in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. They are potent mitogens in vitro.
  • Sequence similarities
    Belongs to the heparin-binding growth factors family.
  • Cellular localization
    Secreted. Cytoplasm. Cytoplasm > cell cortex. Lacks a cleavable signal sequence. Within the cytoplasm, it is transported to the cell membrane and then secreted by a non-classical pathway that requires Cu(2+) ions and S100A13. Secreted in a complex with SYT1.
  • Information by UniProt

Images

  • The purity of ab155608 was determined by SDS-PAGE of reduced FGF1 and staining overnight with Coomassie Blue.

References

ab155608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up