Bioactive grade

Recombinant human FGF1 protein (Animal Free) (ab222361)

Description

  • Product name

    Recombinant human FGF1 protein (Animal Free)
    See all FGF1 proteins and peptides
  • Biological activity

    BALB/c 3T3 cell proliferation: ≤2 ng/ml; ≥ 5.0 x 105 units/mg (typical ED50 is < 1 ng/ml).

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAE SVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYIS KKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
    • Predicted molecular weight

      16 kDa
    • Amino acids

      16 to 155
    • Additional sequence information

      This product is the mature full length protein from aa 16 to 155. The propeptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab222361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.44% Sodium chloride, 0.16% Sodium phosphate

    Lyophilized from a sterile 0.2 micron filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting sterile water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C. Avoid repeat freeze thaws. Upon reconstitution, a small amount of visible precipitate can be expected. A 10% overfill has been added to the total material vialed to compensate for this loss.

General Info

  • Alternative names

    • Acidic fibroblast growth factor
    • aFGF
    • Beta endothelial cell growth factor
    • Beta-endothelial cell growth factor
    • ECGF
    • ECGF beta
    • ECGF-beta
    • ECGFA
    • ECGFB
    • Endothelial Cell Growth Factor alpha
    • Endothelial Cell Growth Factor beta
    • FGF 1
    • FGF alpha
    • Fgf1
    • FGF1_HUMAN
    • FGFA
    • Fibroblast growth factor 1
    • Fibroblast Growth Factor 1 Acidic
    • GLIO703
    • HBGF 1
    • HBGF-1
    • HBGF1
    • Heparin binding growth factor 1
    • Heparin binding growth factor 1 precursor
    • Heparin-binding growth factor 1
    see all
  • Function

    The heparin-binding fibroblast growth factors play important roles in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. They are potent mitogens in vitro.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted. Cytoplasm. Cytoplasm > cell cortex. Lacks a cleavable signal sequence. Within the cytoplasm, it is transported to the cell membrane and then secreted by a non-classical pathway that requires Cu(2+) ions and S100A13. Secreted in a complex with SYT1.
  • Information by UniProt

Images

  • Functional analysis of ab222361
  • 1 µg ab222361 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab222361 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up