Bioactive grade

Recombinant human FGF10 protein (Animal Free) (ab205513)

Description

  • Product name

    Recombinant human FGF10 protein (Animal Free)
    See all FGF10 proteins and peptides
  • Biological activity

    The activity is determined by a proliferation assay using 4MBr-5 rhesus monkey epithelial cell and is typically 20-100 ng/mL. This corresponds to an expected specific activity of 5 x 104 units/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKY FLKIEKNGKVSGTKKENCPYSILEITSVEGVVAVKAINSNYYLAMNKKGK LYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRG QKTRRKNTSAHFLPMVVHS
    • Predicted molecular weight

      19 kDa
    • Amino acids

      40 to 208

Specifications

Our Abpromise guarantee covers the use of ab205513 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     

     

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    Na3PO4

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Reconstitute in sterile water at 0.1 mg/mL. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution.

General Info

  • Alternative names

    • BB213776
    • fd11d03
    • FGF 10
    • FGF-10
    • FGF10
    • FGF10_HUMAN
    • Fibroblast growth factor 10
    • Keratinocyte growth factor 2
    • KGF 2
    • Produced by fibroblasts of urinary bladder lamina propria
    • wu:fd11d03
    • zgc:109774
    see all
  • Function

    Could be a growth factor active in the process of wound healing. Acts as a mitogen in the lung. May act in a manner similar to FGF-7.
  • Involvement in disease

    Defects in FGF10 are the cause of autosomal dominant aplasia of lacrimal and salivary glands (ALSG) [MIM:180920]. ALSG has variable expressivity, and affected individuals may have aplasia or hypoplasia of the lacrimal, parotid, submandibular and sublingual glands and absence of the lacrimal puncta. The disorder is characterized by irritable eyes, recurrent eye infections, epiphora (constant tearing) and xerostomia (dryness of the mouth), which increases the risk of dental erosion, dental caries, periodontal disease and oral infections.
    Defects in FGF10 are a cause of lacrimo-auriculo-dento-digital syndrome (LADDS) [MIM:149730]; also known as Levy-Hollister syndrome. LADDS is a form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. LADDS is an autosomal dominant syndrome characterized by aplastic/hypoplastic lacrimal and salivary glands and ducts, cup-shaped ears, hearing loss, hypodontia and enamel hypoplasia, and distal limb segments anomalies. In addition to these cardinal features, facial dysmorphism, malformations of the kidney and respiratory system and abnormal genitalia have been reported. Craniosynostosis and severe syndactyly are not observed.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Functional analysis of ab205513.

References

ab205513 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205513.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up