Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKY FLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKG KLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRR GQKTRRKNTSAHFLPMVVHS
    • Molecular weight

      19 kDa
    • Amino acids

      40 to 208
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included

Associated products

Specifications

Our Abpromise guarantee covers the use of ab217399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Determined by dose-dependent ability to reduce tetrazolium salt, WST-8, by dehydrogenase activities of BaF3 cells expressing FGF receptors using Cell Counting Kit-8 (CCK-8).

  • Applications

    HPLC

    Functional Studies

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.
    > 95% by HPLC analysis.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • BB213776
    • fd11d03
    • FGF 10
    • FGF-10
    • FGF10
    • FGF10_HUMAN
    • Fibroblast growth factor 10
    • Keratinocyte growth factor 2
    • KGF 2
    • Produced by fibroblasts of urinary bladder lamina propria
    • wu:fd11d03
    • zgc:109774
    see all
  • Function

    Could be a growth factor active in the process of wound healing. Acts as a mitogen in the lung. May act in a manner similar to FGF-7.
  • Involvement in disease

    Defects in FGF10 are the cause of autosomal dominant aplasia of lacrimal and salivary glands (ALSG) [MIM:180920]. ALSG has variable expressivity, and affected individuals may have aplasia or hypoplasia of the lacrimal, parotid, submandibular and sublingual glands and absence of the lacrimal puncta. The disorder is characterized by irritable eyes, recurrent eye infections, epiphora (constant tearing) and xerostomia (dryness of the mouth), which increases the risk of dental erosion, dental caries, periodontal disease and oral infections.
    Defects in FGF10 are a cause of lacrimo-auriculo-dento-digital syndrome (LADDS) [MIM:149730]; also known as Levy-Hollister syndrome. LADDS is a form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. LADDS is an autosomal dominant syndrome characterized by aplastic/hypoplastic lacrimal and salivary glands and ducts, cup-shaped ears, hearing loss, hypodontia and enamel hypoplasia, and distal limb segments anomalies. In addition to these cardinal features, facial dysmorphism, malformations of the kidney and respiratory system and abnormal genitalia have been reported. Craniosynostosis and severe syndactyly are not observed.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab217399 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up