Description

  • Product name

    Recombinant Human FGF12 protein
    See all FGF12 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVG LRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSST LYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQS LHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
    • Predicted molecular weight

      21 kDa
    • Amino acids

      1 to 181

Specifications

Our Abpromise guarantee covers the use of ab151361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.50
    Constituents: 98% Phosphate Buffer, 0.19% EDTA, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • EIEE47
    • FGF-12
    • Fgf12
    • FGF12_HUMAN
    • FGF12B
    • FHF-1
    • FHF1
    • Fibroblast growth factor 12
    • Fibroblast growth factor 12B
    • Fibroblast growth factor FGF 12b
    • Fibroblast growth factor homologous factor 1
    • Myocyte activating factor
    • Myocyte-activating factor
    see all
  • Function

    Probably involved in nervous system development and function.
  • Tissue specificity

    Brain, eye and testis; highly expressed in embryonic retina, olfactory epithelium, olfactory bulb, and in a segmental pattern of the body wall; in adult olfactory bulb, less in cerebellum, deep cerebellar nuclei, cortex and multiple midbrain structures.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab151361 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up