Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKHHHHHHASEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQ VLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLV GKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRE NQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA
    • Molecular weight

      22 kDa including tags
    • Amino acids

      28 to 207
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 28 to 207. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab203708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Western blot

  • Endotoxin level

    < 1.000 Eu/µg
  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 95 % SDS-PAGE.
    Assessed by densitometry. Purifed using Ni-NTA chromatography.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituents: 5% Trehalose, 95% PBS

  • Reconstitution
    Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

General Info

  • Alternative names

    • FGF 18
    • FGF-18
    • Fgf18
    • FGF18_HUMAN
    • FGFI
    • Fibroblast growth factor 18
    • zFGF5
    see all
  • Function

    Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 14 % SDS-PAGE analysis of ab203708:

    1. Reduced and boiled sample, 2.5 μg/lane.
    2. Non-reduced and non-boiled sample, 2.5 μg/lane.

References

ab203708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up