Description

  • Product name

    Recombinant human FGF18 protein (Animal Free)
    See all FGF18 proteins and peptides
  • Biological activity

    Determined by dose-dependent ability to reduce tetrazolium salt, WST-8, by dehydrogenase activities of BaF3 cells expressing FGF receptors using Cell Counting Kit-8 (CCK-8).

  • Purity

    > 95 % SDS-PAGE.
    >95% by HPLC.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISAR GEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKE CVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMK RYPKGQPELQKPFKYTTVTKRSR
    • Predicted molecular weight

      20 kDa
    • Amino acids

      27 to 199

Associated products

Specifications

Our Abpromise guarantee covers the use of ab217400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • FGF 18
    • FGF-18
    • Fgf18
    • FGF18_HUMAN
    • FGFI
    • Fibroblast growth factor 18
    • zFGF5
    see all
  • Function

    Plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. Required for normal ossification and bone development. Stimulates hepatic and intestinal proliferation.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab217400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up