Description

  • Product name

    Recombinant human FGF19 protein (Animal Free)
    See all FGF19 proteins and peptides
  • Biological activity

    Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 for this effect is 100-150 ng/ml.

  • Purity

    >= 95 % SDS-PAGE.
    >= 95 % by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCA RGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCA FEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPM VPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
    • Predicted molecular weight

      22 kDa
    • Amino acids

      23 to 216
    • Additional sequence information

      This product is the mature full length protein from aa 23 to 216. The last residue of the signal peptide (aa 23) is included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab224778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • FGF 19
    • FGF-19
    • FGF15
    • FGF19
    • FGF19_HUMAN
    • Fibroblast growth factor 15
    • Fibroblast growth factor 19
    see all
  • Function

    Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB.
  • Tissue specificity

    Expressed in fetal brain, cartilage, retina, and adult gall bladder.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab224778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up