Description

  • Product name

    Recombinant human FGF2 protein
    See all FGF2 proteins and peptides
  • Biological activity

    Measured in a cell proliferation assay using BALB/c 3T3 mouse embryonic fibroblasts.

    The ED50 for this effect is typically 0.02 - 0.1 ng/ml.

  • Purity

    > 98 % SDS-PAGE.
    ab155734 was lyophilised from 0.22 µm filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH IKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLES NNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
    • Predicted molecular weight

      17 kDa
    • Amino acids

      143 to 288

Specifications

Our Abpromise guarantee covers the use of ab155734 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 200 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Basic fibroblast growth factor
    • Basic fibroblast growth factor bFGF
    • BFGF
    • FGF 2
    • FGF B
    • FGF-2
    • Fgf2
    • FGF2 basic
    • FGF2_HUMAN
    • FGFB
    • Fibroblast growth factor 2
    • Fibroblast growth factor 2 (basic)
    • Fibroblast growth factor, basic
    • HBGF 2
    • HBGF-2
    • HBGF2
    • HBGH 2
    • HBGH2
    • Heparin binding growth factor 2 precursor
    • Heparin-binding growth factor 2
    • Prostatropin
    see all
  • Function

    Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis (PubMed:23469107).
  • Tissue specificity

    Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Post-translational
    modifications

    Phosphorylation at Tyr-215 regulates FGF2 unconventional secretion.
    Several N-termini starting at positions 94, 125, 126, 132, 143 and 162 have been identified by direct sequencing.
  • Cellular localization

    Secreted. Nucleus. Exported from cells by an endoplasmic reticulum (ER)/Golgi-independent mechanism. Unconventional secretion of FGF2 occurs by direct translocation across the plasma membrane. Binding of exogenous FGF2 to FGFR facilitates endocytosis followed by translocation of FGF2 across endosomal membrane into the cytosol. Nuclear import from the cytosol requires the classical nuclear import machinery, involving proteins KPNA1 and KPNB1, as well as CEP57.
  • Information by UniProt

Images

  • Human FGF basic (Tag Free) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 98%.
  • Immobilized ab155734 at 1 μg/mL (100 μL/well) can bind Human Glypican 1, Fc Tag with a linear range of 1-39 ng/mL

  • Immobilized ab155734 at 2 μg/mL (100 μL/well) can bind Human Glypican 3, Fc Tag (ab220538) with a linear range of 0.48-7.8 ng/mL

  • SDS-PAGE analysis of 6µg reduced ab155734 stained overnight with Coomassie Blue.

References

ab155734 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155734.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up