Recombinant Human FGF21 (mutated L174 P) protein (His tag) (ab235134)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMHPIPDSSPLLQFGGQVRQRYLYTDDAQQT EAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPD GALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPA PRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSY AS
    • Molecular weight

      22 kDa including tags
    • Amino acids

      29 to 209
    • Modifications

      mutated L174 P
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 29 to 209. The signal peptide is not included (NP_061986).

Specifications

Our Abpromise guarantee covers the use of ab235134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Endotoxin level

    < 1.000 Eu/µg
  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab235134 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • FGF 21
    • FGF-21
    • Fgf21
    • FGF21_HUMAN
    • FGFL
    • Fibroblast growth factor 21
    • PRO10196
    • UNQ3115
    see all
  • Function

    Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab235134.

    (molecular weight on SDS-PAGE will appear higher)

References

ab235134 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235134.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up