Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSP ESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELL LEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEP PGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
    • Molecular weight

      20 kDa
    • Amino acids

      29 to 209
    • Additional sequence information

      Full length mature chain without signal peptide. Source: Genetically modified E.coli.

Specifications

Our Abpromise guarantee covers the use of ab238297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    3T3 proliferation with β-klotho and heparin ED50 ≤ 500 ng/mL (≥ 2.0 x 10^3 unit/mg).

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    <=1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    12 months from date of receipt when stored at -20°C to -80°C as supplied.
    1 month when stored at 4°C after reconstituting as directed.
    3 months when stored at -20°C to -80°C after reconstituting as directed.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.16% Sodium phosphate, 0.58% Sodium chloride

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • FGF 21
    • FGF-21
    • Fgf21
    • FGF21_HUMAN
    • FGFL
    • Fibroblast growth factor 21
    • PRO10196
    • UNQ3115
    see all
  • Function

    Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Recombinant human FGF21 protein (Active) (ab238297) used at 1 µg.

    4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab238297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up