Recombinant human FGF4 protein (Animal Free) (ab222368)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.050 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human FGF4 protein (Animal Free)
See all FGF4 proteins and peptides -
Biological activity
The activity is determined by its ability to induce the proliferation of mouse NR6R-3T3 fibroblasts and is typically 0.25-1.25 ng/ml. Corresponding to a specific activity of 1.3 x 106 units/mg.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 0.050 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLG IKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIF GVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFI ALSKNGKTKKGNRVSPTMKVTHFLPRL -
Predicted molecular weight
15 kDa -
Amino acids
31 to 206 -
Additional sequence information
This product is the mature full length protein from aa 31 to 206. The signal peptide is not included.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab222368 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 0.16% Sodium phosphate, 0.44% Sodium chloride
Lyophilized from a sterile filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.
General Info
-
Alternative names
- FGF-4
- Fgf4
- FGF4_HUMAN
see all -
Function
Can transform NIH 3T3 cells from a human stomach tumor (hst) and from karposi's sarcoma (KS3). It has a mitogenic activity. -
Sequence similarities
Belongs to the heparin-binding growth factors family. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab222368 has not yet been referenced specifically in any publications.