Bioactive grade

Recombinant human FGF4 protein (Animal Free) (ab222368)

Description

  • Product name

    Recombinant human FGF4 protein (Animal Free)
    See all FGF4 proteins and peptides
  • Biological activity

    The activity is determined by its ability to induce the proliferation of mouse NR6R-3T3 fibroblasts and is typically 0.25-1.25 ng/ml.  Corresponding to a specific activity of 1.3 x 106 units/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLG IKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIF GVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFI ALSKNGKTKKGNRVSPTMKVTHFLPRL
    • Predicted molecular weight

      15 kDa
    • Amino acids

      31 to 206
    • Additional sequence information

      This product is the mature full length protein from aa 31 to 206. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab222368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.16% Sodium phosphate, 0.44% Sodium chloride

    Lyophilized from a sterile filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.

General Info

  • Alternative names

    • FGF-4
    • Fgf4
    • FGF4_HUMAN
    • Fibroblast growth factor 4
    • fibroblast growth factor 4 splice isoform
    • HBGF-4
    • HBGF4
    • Heparin secretory-transforming protein 1
    • Heparin-binding growth factor 4
    • Hst
    • HST-1
    • HST1
    • HSTF-1
    • HSTF1
    • Human stomach cancer transforming factor from FGF related oncogene
    • K FGF
    • Kaposi Sarcoma Oncogene
    • KFGF
    • KS3
    • Oncogene HST
    • Transforming protein KS3
    see all
  • Function

    Can transform NIH 3T3 cells from a human stomach tumor (hst) and from karposi's sarcoma (KS3). It has a mitogenic activity.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Functional analysis of ab222368
  • 1 µg ab222368 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

    ab222368 has a predicted weight of 15 kDa.

References

ab222368 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up