Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAWAHGEKRLAPKGQPGPAATDRNPIGSSSRQSSSSAMSSSSASSSPAAS LGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEAN MLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERF QENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFL PRFKQSEQPELSFTVTVPEKKNPPSPIKSKIPLSAPRKNTNSVKYRLKFR FG
    • Molecular weight

      28 kDa
    • Amino acids

      18 to 268

Associated products

Specifications

Our Abpromise guarantee covers the use of ab219125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Determined by NR6R-3T3 proliferation with 1 ug heparin.

    ED50 ≤10 ng/ml (≥ 1.0 x 105 units/mg).

     

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    <=1.000 Eu/µg
  • Purity

    >= 95 % SDS-PAGE.
    Purity determined by reducing and non-reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: 0.16% Sodium phosphate, 0.58% Sodium chloride

    Lyophilised from a sterile (0.2 micron) filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • FGF 5
    • FGF-5
    • FGF5
    • FGF5_HUMAN
    • Fibroblast growth factor 5
    • HBGF 5
    • HBGF-5
    • heparin binding growth factor 5
    • Heparin-binding growth factor 5
    • Smag 82
    • Smag-82
    • TCMGLY
    see all
  • Function

    Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase.
  • Tissue specificity

    Expressed in neonatal brain.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Developmental stage

    Can transform NIH 3T3 cells.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 4-20% Tris-Glycine SDS-PAGE analysis of 1 µg ab219125, stained with Coomasie blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

  • Proliferation of NR6R-3T3 cells induced by ab219125.

References

ab219125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up