Description

  • Product name

    Recombinant human FGF9/GAF protein (Animal Free)
    See all FGF9/GAF proteins and peptides
  • Biological activity

    Determined by dose-dependent ability to reduce tetrazolium salt, WST-8, by dehydrogenase activities of BaF3 cells expressing FGF receptors using Cell Counting Kit-8 (CCK-8).

  • Purity

    > 95 % SDS-PAGE.
    > 95% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVT DLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAV GLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNL YKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYK DILSQS
    • Predicted molecular weight

      23 kDa
    • Amino acids

      3 to 208
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included

Associated products

Specifications

Our Abpromise guarantee covers the use of ab217397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as FGF9.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituent: PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • FGF 9
    • FGF-9
    • FGF9
    • FGF9_HUMAN
    • Fibroblast growth factor 9
    • GAF
    • GAF (Glia-activafibroblast growth factor 9 (glia-activating factor)
    • Glia Activating Factor
    • Glia-activating factor
    • HBFG 9
    • HBFG9
    • HBGF-9
    • Heparin-binding growth factor 9
    • MGC119914
    • MGC119915
    • SYNS3
    see all
  • Function

    May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
  • Tissue specificity

    Glial cells.
  • Involvement in disease

    Defects in FGF9 are the cause of multiple synostoses syndrome type 3 (SYNS3) [MIM:612961]. Multiple synostoses syndrome is an autosomal dominant condition characterized by progressive joint fusions of the fingers, wrists, ankles and cervical spine, characteristic facies and progressive conductive deafness.
  • Sequence similarities

    Belongs to the heparin-binding growth factors family.
  • Post-translational
    modifications

    Three molecular species were found (30 kDa, 29 kDa and 25 kDa), cleaved at Leu-4, Val-13 and Ser-34 respectively. The smaller ones might be products of proteolytic digestion. Furthermore, there may be a functional signal sequence in the 30 kDa species which is uncleavable in the secretion step.
    N-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab217397 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up