Recombinant human FGF9/GAF protein (Animal Free) (ab256004)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 95% SDS-PAGE
- Endotoxin level: <= 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human FGF9/GAF protein (Animal Free)
See all FGF9/GAF proteins and peptides -
Biological activity
NR6R-3T3 cell proliferation: ED50 ≤ 2 ng/ml (≥ 5.0 x 105 units/mg).
-
Purity
>= 95 % SDS-PAGE. -
Endotoxin level
<=1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
MPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAV TDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIA VGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSN LYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELY KDILSQS -
Predicted molecular weight
23 kDa -
Amino acids
3 to 208
-
Specifications
Our Abpromise guarantee covers the use of ab256004 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at room temperature. Store at -20°C.
Constituents: 0.16% Sodium phosphate, 0.15% Sodium chloride, 0.71% Sodium sulphate
0.2 micron filtered.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in sterile water to 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution.
General Info
-
Alternative names
- FGF 9
- FGF-9
- FGF9
see all -
Function
May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. -
Tissue specificity
Glial cells. -
Involvement in disease
Defects in FGF9 are the cause of multiple synostoses syndrome type 3 (SYNS3) [MIM:612961]. Multiple synostoses syndrome is an autosomal dominant condition characterized by progressive joint fusions of the fingers, wrists, ankles and cervical spine, characteristic facies and progressive conductive deafness. -
Sequence similarities
Belongs to the heparin-binding growth factors family. -
Post-translational
modificationsThree molecular species were found (30 kDa, 29 kDa and 25 kDa), cleaved at Leu-4, Val-13 and Ser-34 respectively. The smaller ones might be products of proteolytic digestion. Furthermore, there may be a functional signal sequence in the 30 kDa species which is uncleavable in the secretion step.
N-glycosylated. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab256004 has not yet been referenced specifically in any publications.